PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G06900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 257aa    MW: 27758.1 Da    PI: 9.5524
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G06900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.84e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed+ l+ ++k +G g W+ ++++ g++R++k+c++rw++yl
  ORUFI06G06900.1 14 RGAWTSKEDDVLASYIKSHGEGKWREVPQRAGLRRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding506.9e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+   +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
  ORUFI06G06900.1  67 RGNIDDDEEELIVRLHTLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111
                      6777789***************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-22663IPR009057Homeodomain-like
PROSITE profilePS5129416.29961IPR017930Myb domain
SuperFamilySSF466893.82E-2711108IPR009057Homeodomain-like
SMARTSM007171.6E-111363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
CDDcd001671.37E-81661No hitNo description
PROSITE profilePS5129424.96662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2364116IPR009057Homeodomain-like
SMARTSM007179.0E-1466114IPR001005SANT/Myb domain
PfamPF002498.6E-1368111IPR001005SANT/Myb domain
CDDcd001676.13E-1072112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRRACCAKE GMKRGAWTSK EDDVLASYIK SHGEGKWREV PQRAGLRRCG KSCRLRWLNY  60
LRPNIKRGNI DDDEEELIVR LHTLLGNRWS LIAGRLPGRT DNEIKNYWNS TLSRKIGTAA  120
TAAAGSRGGS TPDTARATDA ASSSSVVPPG QQQQPASRAD TDTATAAAAA AATTTTVWAP  180
KAVRCTRGFF FHDRETAPLA AAAPAPAGEL GDGDDVDCDY YCSGSTDVVE LIPGGRRAVL  240
LRRRRLDGRR ESLGDIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-26121185110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3797030.0HQ379703.1 Oryza sativa Japonica Group isolate Z418-A C1 protein (C1) mRNA, complete cds.
GenBankY152190.0Y15219.1 Oryza sativa mRNA for transcriptional activator.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642631.11e-129PREDICTED: anthocyanin regulatory C1 protein
SwissprotP102901e-84MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0E0PUU70.0A0A0E0PUU7_ORYRU; Uncharacterized protein
STRINGLOC_Os06g10350.11e-128(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.12e-58myb domain protein 7